General Information

  • ID:  hor005288
  • Uniprot ID:  P41336
  • Protein name:  Pancreatic hormone
  • Gene name:  PPY
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APPEPVYPGDDATPEQMAEYVADLRRYINMLTRPRY
  • Length:  36
  • Propeptide:  APPEPVYPGDDATPEQMAEYVADLRRYINMLTRPRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a regulator of pancreatic and gastrointestinal functions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PPYR1
  • Target Unid:  B6VRS6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41336-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P41336-F1.pdbhor005288_AF2.pdbhor005288_ESM.pdb

Physical Information

Mass: 482118 Formula: C186H284N50O57S2
Absent amino acids: CFHKSW Common amino acids: P
pI: 4.36 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 9
Hydrophobicity: -86.39 Boman Index: -8843
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 59.72
Instability Index: 6885.83 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  8299350
  • Title:  Rabbit pancreatic polypeptide.